Protein Info for A4249_RS04365 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 44 to 69 (26 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details PF00487: FA_desaturase" amino acids 48 to 144 (97 residues), 40.5 bits, see alignment E=1.5e-14 amino acids 132 to 239 (108 residues), 43.5 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 52% identical to CRTW_PARS1: Beta-carotene ketolase from Paracoccus sp. (strain PC1)

KEGG orthology group: K09836, beta-carotene ketolase (CrtW type) (inferred from 58% identity to bsb:Bresu_2277)

Predicted SEED Role

"Beta-carotene ketolase (EC 1.14.-.-)" in subsystem Carotenoids (EC 1.14.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HX78 at UniProt or InterPro

Protein Sequence (241 amino acids)

>A4249_RS04365 fatty acid desaturase (Brevundimonas sp. GW460-12-10-14-LB2)
MSAVTPMSRVVPNQALIGLTLAGLIAAAWLTLHIYGVYFHRWTIWSVLTVPLIVAVQTWL
SVGLFIVAHDAMHGSLAPGRPRLNTAIGSLALALYAGFRFAPLKTAHHAHHAAPGTADDP
DFHADSPSAFLPWFYGFFRTYFGWRELAVLTVLVAVAVLILGARIPNLLVFWAAPALLSA
LQLFTFGTWLPHRHTDDAFPDNHNARTSPFGPVLSLLTCFHFGRHHEHHLTPWKPWWSLF
S