Protein Info for A4249_RS04225 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DNA mismatch repair endonuclease MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 316 (316 residues), 280.1 bits, see alignment E=1.6e-87 PF02518: HATPase_c" amino acids 22 to 77 (56 residues), 26.8 bits, see alignment 1.2e-09 PF13589: HATPase_c_3" amino acids 24 to 125 (102 residues), 39.9 bits, see alignment E=8.4e-14 PF01119: DNA_mis_repair" amino acids 219 to 335 (117 residues), 127.5 bits, see alignment E=4.3e-41 PF08676: MutL_C" amino acids 446 to 587 (142 residues), 165.8 bits, see alignment E=1e-52

Best Hits

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 62% identity to mmr:Mmar10_0616)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NWT5 at UniProt or InterPro

Protein Sequence (630 amino acids)

>A4249_RS04225 DNA mismatch repair endonuclease MutL (Brevundimonas sp. GW460-12-10-14-LB2)
MPIRRLSPETVNRIAAGEVVERPASAIKELVENALDAGGRNIEIQADGGGLSRILIADDG
KGIPKAELPLAIERHATSKLEPDDAGDVDLLRIHTLGFRGEALPSIGSVARLSITTRSRD
ETEAWAITVEGGETRPLAPAPFPGSHGARVEVRDLFYATPARLKFMKSERSEAMAISEEI
KRQAMAHEAVAFTLSLDGKVTLRLPAEHPGDEGRLKRLSALLGRDFEANALLIDQERDGV
RLSGYAGLPTYSRGNAAHQYLFVNGRPVKDRLLQGALRGAYADFLARDRHPAAVLFLDID
PLYVDVNVHPAKAEVRFRDPALVRGLIVGALRHALHAAGHRASTTVAADALSGFQPHTGV
ASGPAYSPSAPSAQGFSGWTGWSQPAAAAQILPGLNERSARVEPSWDGPSWPQQPTARDP
SAHDSRLTPHPAPADPLDYPLGAARGQLHANYIVAQTRDGLVIVDQHAAHERLVYERMKA
QMAEGAVTRQALLTPEVVDLDPAEAERVAGRAQELAEMGLIVEAFGAGAVLVRETPAMLG
DTDVQGLIRDIADDLSEHGQALSLKERLAAICGTMACHGSVRSGRVLSAPEMNALLRQME
ATPHSGQCNHGRPTYVELKLHDLEKLFGRR