Protein Info for A4249_RS04135 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 43 to 318 (276 residues), 93.3 bits, see alignment E=2.3e-30 PF00005: ABC_tran" amino acids 385 to 534 (150 residues), 109.9 bits, see alignment E=1.6e-35

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 81% identity to bsb:Bresu_2394)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NE35 at UniProt or InterPro

Protein Sequence (616 amino acids)

>A4249_RS04135 ABC transporter ATP-binding protein/permease (Brevundimonas sp. GW460-12-10-14-LB2)
MVKAQQAGSPQDKTDGPPTLTALADLARLVVRSGAPHLRLRLISAILLTLAGKGLGVMAP
LVLGAAVNRLAAGQGAATAVGLGFAAFAIGWTVVRFLSAASPLISDVVFAPVRAAAQRAT
AAEAFAHALSLSLDFHQTKRSGALSRTMDRGSRAVDFLLRILAFNLVPTGVELVLAAGVL
GAKYDWRFAAVAVVVVVIYTAATFAMSNWRLEHRRIMNAADSEAAGVSVDALLNYETVKS
FGAETRAAQTYDRALGDYAEASLKANSSLNMLNGMQALVMNLGLGVMAVMAGFEAAAGRM
GPGDVTAAVLIMISLYAPLNILGFAYREIRQSFIDMEEMLKVTRQTPQVADSPNAFALPR
PVDARGASVAFEAVGFRHDARANGLEDVSFYAAPGTTTALVGPSGAGKSTIVKLALRLLD
PQEGRVLIDGHDAREVTQASLRSAVALVPQDVALFNDTLAANIAFARPEADEAEVWAAAE
AAELADFIRGLPDGMQTKVGERGLKLSGGERQRVGIARALLADPCILILDEATSALDSRT
EAAIQKTLRKARNGRTTLVVAHRLSTVADADQILVLKAGRIVERGGHHELVARQGGEYAA
LWRKQTRGGKTPQMAD