Protein Info for A4249_RS04125 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 109 to 135 (27 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 29 to 70 (42 residues), 23 bits, see alignment 1.2e-08 PF21088: MS_channel_1st" amino acids 85 to 125 (41 residues), 37.8 bits, see alignment 3e-13 PF00924: MS_channel_2nd" amino acids 127 to 192 (66 residues), 67.3 bits, see alignment E=2e-22 PF21082: MS_channel_3rd" amino acids 199 to 281 (83 residues), 46.9 bits, see alignment E=6.1e-16

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 68% identity to bsb:Bresu_2254)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXX4 at UniProt or InterPro

Protein Sequence (317 amino acids)

>A4249_RS04125 mechanosensitive ion channel family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSLPLSNEVADAVAAGRKAVSIDAAVIAKLTDMAGDFAINLTIAILIFVLTVFAAKWAAR
GARNTLSRVKGFRHDPTVLSFAVQVVRVVVFIIGMIAVLQRLGVQTTSIIAVLGAASLAV
GLALQGTLSNVASGIMLLVLRPYRVGDVVDVGGMSGTVQRLDLFTTQLSNANNHKIVIPN
SKVLSDPLTNLTGQQTRRIEINFTVGYGDDLNQARCVLADMAAAHDKVLHDPHPWTGVTG
LLDSSVQVTLHAWVKVGDWWQTQADLMQGGKEALDAAGIEIPFPHQVAVPYGDEDVVPVV
RVRTVDDDNAELKATNR