Protein Info for A4249_RS03825 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details amino acids 280 to 306 (27 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 25 to 422 (398 residues), 185.6 bits, see alignment E=7.3e-59 PF01554: MatE" amino acids 25 to 184 (160 residues), 78 bits, see alignment E=6.9e-26 amino acids 255 to 412 (158 residues), 83.4 bits, see alignment E=1.5e-27 PF14667: Polysacc_synt_C" amino acids 138 to 222 (85 residues), 34.3 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 53% identical to NORM_CAUVC: Probable multidrug resistance protein NorM (norM) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 77% identity to bsb:Bresu_1585)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HVV2 at UniProt or InterPro

Protein Sequence (452 amino acids)

>A4249_RS03825 MATE family efflux transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MPRPMIALSPQTRTAFRDLLNLAWPVILARIGIMTMGLTDAIVVGNYSSQELAFHSLAWA
PTSIVVTTAVGLMLGVQVMTARMLGEGRRHAVGSVLRRGLTYSLQIGVVSMIALIAIGPW
GLGKLGLEDGLAEGAGPALVVFALSMPFYLISVTGQFFLEALGRPKPGMVAMWVANGVNL
ALNIVLVPDLLGFGFDGAFASAWATFGARAALAIFLVIYILRLPEARALGIFDKPERDPK
AAREQVKVGLGAGASYFIEVGAFSGFTFFAGQIGTAETAAWAVVLNVSAIVFMLPMGLSS
ATAVLVGRSYGAGDGRGVMRAGLVGLGVVTALTLVVALLVWPSAHLIVGAYNRDPTLLAI
AAPALVLATLFFVADGIQVVAAQANRAAGDVWWPTIMHFAAYGAVMMPLGWVLAHQMGVN
GLVWAVVIASLASSTLLTGRFIRIARRLPQGV