Protein Info for A4249_RS03760 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF00772: DnaB" amino acids 22 to 123 (102 residues), 94.4 bits, see alignment E=5.9e-31 TIGR00665: replicative DNA helicase" amino acids 22 to 487 (466 residues), 494.6 bits, see alignment E=1.2e-152 PF03796: DnaB_C" amino acids 198 to 485 (288 residues), 333 bits, see alignment E=1.7e-103 PF13481: AAA_25" amino acids 212 to 391 (180 residues), 50.8 bits, see alignment E=2.5e-17

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 86% identity to bsb:Bresu_2602)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXQ4 at UniProt or InterPro

Protein Sequence (496 amino acids)

>A4249_RS03760 replicative DNA helicase (Brevundimonas sp. GW460-12-10-14-LB2)
MNAFAPMPFSSSPLDSGGVTSMPHNLEAEQALLGSLMFDNAVFERLNDRLRGSHFYEPFH
QRLFDAIEDHIRQGLLAEPTILMERFKQDPAFQEFGGLRYLADLVDRAPPAANAPDYARV
VYDLALRRDLIRIGGDMIKEAPNPETPADEQIEQAEQTLYSLAETGKPSSGFVSFSNALS
GAVQMAAEAYQREGKLAGLATGLNDLDRKLGGLHPSDLLILAGRPSMGKTALATNMAFNV
ARAYQWEPTPEGRKTVNGGVVAFYSLEMSAEQLAMRILADASGVSSDKLRKGEIDATDFG
KLRDAAVEIGESPLYIDATGGLSISKLAARARRLKRMEHGLDLIIVDYLQLVTTGNSGGQ
KNRVQEVSEITGGLKALAKELSVPIIALSQLSRQVEQRDDKRPQLSDLRESGSIEQDADC
VMFVYRESYYLGRAEPREGTEEHLQWQQDMDRLQGQAEVVIGKQRHGPIGIVKLAFDADT
VRFGNLAHGYEEVSYE