Protein Info for A4249_RS03735 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR01134: amidophosphoribosyltransferase" amino acids 27 to 474 (448 residues), 488.8 bits, see alignment E=1e-150 PF13522: GATase_6" amino acids 92 to 222 (131 residues), 72.5 bits, see alignment E=5.1e-24 PF13537: GATase_7" amino acids 111 to 226 (116 residues), 76 bits, see alignment E=3.9e-25 PF00156: Pribosyltran" amino acids 297 to 399 (103 residues), 33 bits, see alignment E=5.5e-12

Best Hits

Swiss-Prot: 59% identical to PUR1_RHIEC: Amidophosphoribosyltransferase (purF) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 85% identity to bsb:Bresu_2358)

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HYA7 at UniProt or InterPro

Protein Sequence (501 amino acids)

>A4249_RS03735 amidophosphoribosyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MRHHIADPVVHREHWREPEDDQLRLECGVCGVWGADEDEGSSVVALGLHALQHRGQEACG
IASVKDERFYTERHQGLVGEAFGGADLMTRMPGRAAVGHTRYSTAGGSFLRNIQPMFADL
DQGGIAIAHNGNLTNFKFLHAQLVSEGAIFQSTSDSEVILHLIARSRKAKIVDRFTDALA
RIEGGYALVAQTRTKMIGARDPLGIRPLVLGQLGDGWVLASETCALDMMGATFVRDVEHG
EIVVIDDSGLRSLKPFPARAARPCLFEYVYFSRPDSVVNGRSVYEVRKEMGRGLARELGV
EADIVVPVPDSGVPAALGYAQESGIPYEMGIIRSHYLGRTFIQPSQGARQKGVRMKHSPN
KSALAGKRVVLIDDSIVRGTTSLKLVRAVRAAGATEVHLRSASPQILFPDFYGIDMPERA
QLLAANKTLEEMRDMLEVDSLGFLSIDGLYRAMGETGRNPAAPQFTDHYFTGDYPTRLLD
REIEEGGREFGAKQLSLLVSA