Protein Info for A4249_RS03285 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: copper resistance system multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 2 to 613 (612 residues), 840.7 bits, see alignment E=3.2e-257 PF07732: Cu-oxidase_3" amino acids 53 to 162 (110 residues), 122.5 bits, see alignment E=1.5e-39 amino acids 500 to 614 (115 residues), 23.8 bits, see alignment E=5.9e-09 PF00394: Cu-oxidase" amino acids 239 to 331 (93 residues), 86.6 bits, see alignment E=3e-28 PF07731: Cu-oxidase_2" amino acids 493 to 614 (122 residues), 109.7 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: None (inferred from 67% identity to mea:Mex_p20030)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXJ3 at UniProt or InterPro

Protein Sequence (620 amino acids)

>A4249_RS03285 copper resistance system multicopper oxidase (Brevundimonas sp. GW460-12-10-14-LB2)
MKLDRRLLLRGAVAGGGLAALQGLMPAWAQTGSPGLRSDLPTLTGPNIDLTIGQTPFTVN
GRTATATTINGVLPAPVLRLREGQNVRLAVTNTLDEDTSIHWHGILLPFQMDGVPGISFP
GIKPRETFVYEFPIRQSGTFWYHSHSGLQEALGHYGPIVIDPAGADPVAYDREHVLVLSD
WSFMHPHEILDKLKKSPGYFNRQRTTLAGLFSGEDRMSLEERRMWGQMRMDPRDILDVNG
TTYTYLINGHGPQENWTGLFRPGERVRLRIINASAMSIFNVRIPGLSMTVVQADGENVRP
VETDEFQISVAETYDVIVRPTEDRAYTIVSEAIDRSGMGRATLAPRLGMTAEVPPLREVP
NLTMKDMGMGDMGGMGGMDHGSMGGQPGGAMAGMDHGAMTGASGGAMAGMDHGAMATQST
GAMTGMDHGSMAGMSMRDPANAPPDMAVGVGVDAIAMAPANRMGERPTGLADVPHRVLVY
TDLVSLTPNKDQRPPSRTMEIHLTGNMERFMWGFDGRKFSELVEPIRFERNERVRVTLVN
DTMMAHPIHLHGHFFELVTGGPAGHQPLKHTVNVLPGGKVTFDLTADNPGDWAFHCHMLM
HMHAGMFNVVTVRPMTGASS