Protein Info for A4249_RS03280 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF305 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details PF03713: DUF305" amino acids 107 to 160 (54 residues), 48.7 bits, see alignment E=4.6e-17

Best Hits

KEGG orthology group: None (inferred from 55% identity to sch:Sphch_4186)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I2F8 at UniProt or InterPro

Protein Sequence (163 amino acids)

>A4249_RS03280 DUF305 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MEKMKTMDSKMKTMDSMKGSYRSFGVELIVDFIIMYLVMYTMIASLNHFYFNLNNVYMTL
MMVSPMAILMLIFMRSMYPSKRTNLLIGGAAALVFAVSFYGMRTQAAVGDTEFLKSMIPH
HSGAILMCQQASLTDPEVLGLCEEIVSSQEREIAQMKAILARR