Protein Info for A4249_RS03090 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cytochrome c/FTR1 family iron permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 386 to 411 (26 residues), see Phobius details amino acids 423 to 446 (24 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details amino acids 500 to 525 (26 residues), see Phobius details amino acids 532 to 554 (23 residues), see Phobius details amino acids 564 to 587 (24 residues), see Phobius details amino acids 607 to 630 (24 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 131 to 213 (83 residues), 37 bits, see alignment E=5.4e-13 PF00034: Cytochrom_C" amino acids 133 to 213 (81 residues), 33.4 bits, see alignment E=1.4e-11 PF03239: FTR1" amino acids 368 to 501 (134 residues), 64.7 bits, see alignment E=1.3e-21 amino acids 487 to 591 (105 residues), 45.3 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 67% identity to cak:Caul_2302)

Predicted SEED Role

"High-affinity Fe2+/Pb2+ permease precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXJ2 at UniProt or InterPro

Protein Sequence (643 amino acids)

>A4249_RS03090 cytochrome c/FTR1 family iron permease (Brevundimonas sp. GW460-12-10-14-LB2)
MRPLLRLFALLFAMGLAAPALAQAPSASEAQVAWRLLDYVAVDYAGAVADGQVTNPAEYG
EMIEFGGQIRTRLDALPPNPAKAGLVRDAEALQAAIRDKADPRVVGDRAKALAGAVLTAY
PSPLAPSFPPDLARGATLYAEQCSVCHGVTGRADGPGAEGLDPPAIAFADVERARQRSVF
GLYQVIDQGLEGTAMASFAHLPAEDRWALAFYVGRFAFTDAEAAEGRRLWESDPAIRAVF
PDLAALTQATPAELATRIGETKARAVTAYLRRHPEATVRAEGSTLSLARTRLAESEAAYR
RGDRRAATDLALSAYLDGVEPMEPALGARDGALLRRVETAMTDLRVSISRGAPAQEVADR
VARANALLDTAERALAPQEADNLASFLGAFTILLREGLEAILIVVAMIAFLRKAERPEVL
RYVHGGWVAALVAGGATWAAATFFISISGASRELTEGFGSLLAAVVLVSVGIWMHGKSHA
DAWQTYIRDKLSHALSKRSAWFLFLLAFVVVYREVFETILFYAAIWSQGGHLGMLAGALT
AVAILAVVAWALLAYSKRLPIGRFFSLSSILMAILSVVLVGKGVAALQEAGWLDVHPLAW
IPRIEILGLYPTVEGVAVQLLTIAILVVGFSRHAAPKGARPAS