Protein Info for A4249_RS03085 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: Fic family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF13776: DUF4172" amino acids 4 to 85 (82 residues), 107.4 bits, see alignment E=3.7e-35 PF02661: Fic" amino acids 114 to 225 (112 residues), 66.8 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: None (inferred from 75% identity to sal:Sala_2616)

Predicted SEED Role

"Fic family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HY18 at UniProt or InterPro

Protein Sequence (369 amino acids)

>A4249_RS03085 Fic family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MAQYIHEIEGWPRLDWRADALADRLAAVRHRQGLLLGRMHTLGFDLRAEAVLETLTEDVL
KSSEIEGELLDKDQVRSSIARRLGMDIGALAAADRNVEGVVEMMLDATQNFASPLTEERL
FAWHAALFPTGRSGMTRIVVGAWRNESSGPMQVVSGPFGRERVHYEAPLADRLQDEMRAF
LDWFNDEPRTDPVLKAAIAHLWFVTIHPFDDGNGRIARAIADMALARSEKSAQRFYSMSA
QIRLERKDYYATLEATQKGALDVSLWLDWFLGCLDRAFDGAETTLTHVMRKARFWEALAG
QTLSERQSTVINRLLDGFEGKLTSTKWAALTRSSPDTALRDINDLVERGILVKDEGGGRS
TSYSLVDRG