Protein Info for A4249_RS03080 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: arsenical resistance protein ArsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR02690: arsenical resistance protein ArsH" amino acids 16 to 230 (215 residues), 380.3 bits, see alignment E=9.8e-119 PF03358: FMN_red" amino acids 38 to 183 (146 residues), 111.4 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 74% identical to ARREH_SHIFL: NADPH-dependent FMN reductase ArsH (arsH) from Shigella flexneri

KEGG orthology group: K11811, arsenical resistance protein ArsH (inferred from 79% identity to rpa:RPA2259)

Predicted SEED Role

"Arsenic resistance protein ArsH" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NCZ5 at UniProt or InterPro

Protein Sequence (251 amino acids)

>A4249_RS03080 arsenical resistance protein ArsH (Brevundimonas sp. GW460-12-10-14-LB2)
MTFARLRSLPDPDHLPALDAAYLSNDPAAGLGPHDHPPRILLLYGSLRERSYSRLCVEEA
ARLLQRMGCETRIFDPSNLPLPGSPGDDDHPAVRELREHAFWSEGMVWCSPERHGQVSGL
MKLQIDHLPLSLGGMRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMITIPNQSSVA
KAFQEFDEAGRMKRSAYYERIVDVMEELVRFTILTRPHAARLVDRYSERKAAGIAVDAAS
DLSAIAIARQA