Protein Info for A4249_RS03075 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: arsenic resistance N-acetyltransferase ArsN2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 27 to 105 (79 residues), 32.7 bits, E=1.2e-11
• PF13508: Acetyltransf_7
  • amino acids 29 to 106 (78 residues), 36.5 bits, E=7.9e-13
• PF13673: Acetyltransf_10
  • amino acids 31 to 118 (88 residues), 30.3 bits, E=5.5e-11

Best Hits

KEGG orthology group: K00619, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 53% identity to sjp:SJA_C1-04270)

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• L-ornithine biosynthesis I (4/5 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

See A0A160HVE3 at UniProt or InterPro

Protein Sequence (139 amino acids)

>A4249_RS03075 arsenic resistance N-acetyltransferase ArsN2 (Brevundimonas sp. GW460-12-10-14-LB2)
MVVLHLLDSDDAGLIAVLQGEGLPEPGAGRYFRAEDDSALAGYVGLEGEGRDLLLRSLVV
SADRKAQGLGSRILTAAEALANEMGGERLHLLTTTAEPFFIRRGFATADRETAPEAIRRT
REFTDICPASAAYLTKDLG