Protein Info for A4249_RS03070 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ACR3 family arsenite efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 321 to 345 (25 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 14 to 343 (330 residues), 438.4 bits, see alignment E=9e-136 PF01758: SBF" amino acids 59 to 254 (196 residues), 196.8 bits, see alignment E=1.4e-62

Best Hits

Swiss-Prot: 64% identical to ARSB_BACSU: Arsenite resistance protein ArsB (arsB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 79% identity to sal:Sala_2405)

MetaCyc: 64% identical to arsenite efflux transporter Acr3 (Bacillus subtilis)
TRANS-RXN0-264

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HVL1 at UniProt or InterPro

Protein Sequence (361 amino acids)

>A4249_RS03070 ACR3 family arsenite efflux transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MIDTPLVQTGPRRLSFLDRWLTLWIFVAMGSGVALGTLAPGLSAWVDGLSVGTTNIPIAI
GLILMMYPPLARVRYEELPRVFADKRVLALSLFQNWVLGPVLMFALAVIFLRDQPEYMTG
VILIGLARCIAMVLVWNQLARGDDQYVAGLVAFNSIFQILFFSLYAWVFLTVLPPLFGLQ
GSVVDVSVWTIAGAVLVYLGLPFLAGFLTRRSLIARRGADWYERRFLPRIGPITLIALLF
TIVVMFSLKGGEVVALPLDALRIAIPLTIYFLVMFVVSFLMGKLIEADYPRTTALAFTAA
SNNFELAIAVAIAAFGLTSPVAFAAVIGPLVEVPVLILLVSVALWMGRRWFPDTAPPADA
V