Protein Info for A4249_RS03040 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01705: putative 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  • amino acids 2 to 204 (203 residues), 286.8 bits, E=5.7e-90
• PF01048: PNP_UDP_1
  • amino acids 135 to 201 (67 residues), 33.8 bits, E=1.2e-12

Best Hits

KEGG orthology group: K01243, S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [EC: 3.2.2.9] (inferred from 67% identity to hel:HELO_1484)

Predicted SEED Role

"5'-methylthioadenosine nucleosidase (EC 3.2.2.16) @ S-adenosylhomocysteine nucleosidase (EC 3.2.2.9)" (EC 3.2.2.16, EC 3.2.2.9)

MetaCyc Pathways

• S-methyl-5'-thioadenosine degradation IV (1/1 steps found)
• autoinducer AI-2 biosynthesis II (Vibrio) (4/6 steps found)
• S-methyl-5'-thioadenosine degradation I (1/2 steps found)
• autoinducer AI-2 biosynthesis I (3/5 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (2/12 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.16 or 3.2.2.9

Sequence Analysis Tools

See A0A160HWR8 at UniProt or InterPro

Protein Sequence (237 amino acids)

>A4249_RS03040 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (Brevundimonas sp. GW460-12-10-14-LB2)
MKLARHGEVSLLYVMAAPAEYGPHLQARIAPLMTGVGPVEAAVSLSAALARLAAAGDRPD
PIVSLGSCGSQVLDHAAVYQASSVAYRDMDASPLGFPKGVTPLLDQPAVLPLPCPIPGVP
TATLSTGANVVSGAAYDAIDAEMVDMETWALVRAAQTFGVPLIALRGVSDGRAELKALED
WTSTLHHVDENLAAALDRLIAVLEADGPAALELPALEISAPPGQDPAQLPAPDSITP