Protein Info for A4249_RS03035 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: RsmB/NOP family class I SAM-dependent RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01209: Ubie_methyltran" amino acids 222 to 306 (85 residues), 21 bits, see alignment E=2.8e-08 PF01189: Methyltr_RsmB-F" amino acids 231 to 428 (198 residues), 124.9 bits, see alignment E=5.4e-40

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 58% identity to aex:Astex_2655)

Predicted SEED Role

"Sun protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXI2 at UniProt or InterPro

Protein Sequence (433 amino acids)

>A4249_RS03035 RsmB/NOP family class I SAM-dependent RNA methyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTPAARLAAAASVLDSIAQGRQPAEAVMKAWGTANRYAGSKDRRAIADRVYKVLRARGRL
SWIMGGREDGRALVIGSLHAIDGLSLEEIEALHSGDGYGPRPLSKQERSRITAGQGELPG
WVAAGLPEFVVEDFKATFGDRWAEEAHALMAPRAPIDLRVNDTAATVDEVEAELKVAGLD
VSRTPWSAVGLRMPSEPPPNIQALEGFKAGRFEIQDEGSQVVCWLAGAAPGMTVVDYCAG
GGGKTLGLAQAMKGQGKLVASDVVNKRLENIRPRLQRAGVEAELVLIGQNGGGLEDLNGQ
ADLVFVDAPCSGSGTWRRRPEDAWRLTAEEVEKLHGLQVRILSQATKLVKPGGRLVYVTC
SMLARENEASVDAFEAANPDFRPVPVADVLSAPQLSQAAQAKFAELASGARLRLSPASAD
TDGFFAAVYERAA