Protein Info for A4249_RS03020 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF2061 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details PF09834: DUF2061" amino acids 14 to 64 (51 residues), 70.3 bits, see alignment E=7.2e-24 amino acids 117 to 167 (51 residues), 69.2 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: None (inferred from 66% identity to bsb:Bresu_1633)

Predicted SEED Role

"FIG00449766: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HVD6 at UniProt or InterPro

Protein Sequence (181 amino acids)

>A4249_RS03020 DUF2061 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MVGVILSTARKLALKIASYGVMHLIVAILVAFAITRDWRIALAVGMVEPIFQTIAYTVHD
RVWHKVERRRMASNIEEATEAFTARLDIMSPEEQRRSHDAHHGHSHALPRSFKQIALKTV
TYGVMHFAVAVAVAYALTNDIRTALTIGMVEPLVQTLFFALHDRIWSRIEERRARSAVAT
A