Protein Info for A4249_RS02935 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 49 to 71 (23 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 359 (328 residues), 107 bits, see alignment E=5.2e-35

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 50% identity to pmy:Pmen_1497)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NCM7 at UniProt or InterPro

Protein Sequence (401 amino acids)

>A4249_RS02935 MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTARSDATPARGASLLLLAAIVALALNLRPAMAAVGPLLDLIEAATGMGSTAASLLTTLP
VLMIGLGALSIRPLRRRLGERRGILLGALLIGGACLVRVVLTGATGLIASAVVVGVGVAL
IQALAPVVIKRAFPAQFGTVMALYTTGIMGGAAVAAATAAGLAETIGWAGTLALWSAPAF
VAALVWLAASRDPAAEEPNRAAVIEATDPELPFWRQGRAWRLILIMGLGTSAYTLMLAWL
PPFYIDLGEPRATAGYLLSGMTAAEVTAGLLVSLTIGRFADRRGPILTALALALAGLAGL
VVAPLSMAVPIVIVLGLGIGAIFPLSLILAMDQIDDPARSGDLLAFVQGGGYIIASLSPL
GAGLLRDHLADLTQAWVLMGVGGILLGAMTLEFRPGLPKLR