Protein Info for A4249_RS02895 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 809 PF08447: PAS_3" amino acids 185 to 271 (87 residues), 51.6 bits, see alignment E=3.3e-17 amino acids 314 to 396 (83 residues), 62 bits, see alignment E=1.9e-20 TIGR00229: PAS domain S-box protein" amino acids 287 to 408 (122 residues), 77.8 bits, see alignment E=4e-26 PF00989: PAS" amino acids 291 to 400 (110 residues), 43.9 bits, see alignment E=7.5e-15 PF08448: PAS_4" amino acids 297 to 404 (108 residues), 49.9 bits, see alignment E=1.2e-16 PF13426: PAS_9" amino acids 306 to 402 (97 residues), 36 bits, see alignment E=2.4e-12 PF00512: HisKA" amino acids 423 to 489 (67 residues), 69.9 bits, see alignment E=5.5e-23 PF02518: HATPase_c" amino acids 536 to 651 (116 residues), 97.2 bits, see alignment E=2.9e-31 PF00072: Response_reg" amino acids 672 to 785 (114 residues), 94.1 bits, see alignment E=2.2e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NCF4 at UniProt or InterPro

Protein Sequence (809 amino acids)

>A4249_RS02895 PAS domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MPYIAKSLEALDAPAGPFQRLTELACTVFDAPAAVVTLVSGDNAVLWCSDRELVRSLPRE
RTLGDRLLRQGKGAVLVVEDGLADPAARNHFLVAPPYNLRFYAGVTICGPDGQPLGAFGV
MDRQPRPHPTDAQIATLRTLGAMAEDIMASLEVGRVSDERHGTLELIENMAGVGHWRLEL
ASGKVHWSDEVFRIHGLDRKTFDPQVDSAIDRYHPDDRPGLLAAIAHSAETGDGYKMRLR
LIRADGEERTVLTQARAERDDAGVVKVLYGVFQDITDQQAQIARAQRDEARYRLLAENVG
DVITRVRPDGTSKYISPAIESLLGWTTEEMNGRPMDYVHPDDREMVTRAVLGTIHTKEPC
RLEHRALHRDGSIVWVECTFRALAAEAGKPSEVVVVIRDMTDRKILADELVTARDRAEAA
AAAKSEFLANMSHELRTPLTSVIGFSNLLKASEALPEAEKGYVARIATASEALLSVINDV
LDYSKLEAGMIELEPQRFNPAALAHETVQMMEAQCLAKGLALHVDLAPDMPDCLMGDQAR
LRQILLNLLGNAVKFTSQGSVSLSVGGALEANGAWRLTAEVTDTGIGMSPQTQAHLFERF
SQADRSTTRLYGGTGLGLAISRRLARAMDGDIVVTSQPGLGSTFKVTVPLHIAEGGSEAE
GPRLSVMPEGRVLIADDAPANRELISVILVGMGLEVATASDGAEAVHAVQSEVYDLVLMD
MQMPVMDGLTATREIRRIEHGGGRRLPIIALSANVQPDQIQLCRDAGMDDHLAKPLQLPA
LVATLSKYLDKSNASIAADATAPGRFATH