Protein Info for A4249_RS02835 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 364 to 386 (23 residues), see Phobius details amino acids 398 to 414 (17 residues), see Phobius details PF00083: Sugar_tr" amino acids 22 to 213 (192 residues), 90.7 bits, see alignment E=1e-29 amino acids 211 to 424 (214 residues), 39.6 bits, see alignment E=3.3e-14 PF07690: MFS_1" amino acids 35 to 369 (335 residues), 105.6 bits, see alignment E=2.8e-34

Best Hits

Swiss-Prot: 58% identical to KGTP_SHIFL: Alpha-ketoglutarate permease (kgtP) from Shigella flexneri

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 79% identity to bsb:Bresu_1340)

MetaCyc: 58% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"Alpha-ketoglutarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NC36 at UniProt or InterPro

Protein Sequence (428 amino acids)

>A4249_RS02835 MFS transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTTTAPMSPARRLRNIVGGSAGNLVEWFDWYAYAAFTLYFAPVFFPSEDPTAQLLSAAAV
FAVGFLMRPIGAWIMGVYADRKGRKAGLTLSVTLMCTGSLIIGVTPGYATIGLAAPALLL
FARLLQGLSVGGEYGSSATYLSEMAEPHRRGFWSSFQYVTLISGQLIALLLLIVLQNTLS
ETALASWGWRIPFFVGAGLAVVVFWLRRRLDETHKATEAKDAPKSSAVQLILKHPKEALM
VLGLTAGGTLAFYTYTTYLQKFLVNTSGFSKNTATEISAAALFIFMLLQPAVGALSDRVG
RRPVMIAFGVLGVLCTVPIMTTLSTVESPFVAFLLALAGLVIVSGYTAINAVVKAELFPA
HIRALGVALPYAIANAVFGGTAEYVALWLKGVGVESVFFWYVTGMIGLSLLTFIRMRDTK
HNSLITHT