Protein Info for A4249_RS02780 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details PF00892: EamA" amino acids 28 to 152 (125 residues), 41.1 bits, see alignment E=9.8e-15 amino acids 162 to 299 (138 residues), 54.7 bits, see alignment E=6.4e-19

Best Hits

KEGG orthology group: None (inferred from 68% identity to bsb:Bresu_2630)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NBT0 at UniProt or InterPro

Protein Sequence (312 amino acids)

>A4249_RS02780 DMT family transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MTDVRSKVAPAPAPLPKRPHALTGLEIAAIVAIIVVWGVNNAGAKLATQELSPLLVGAIR
FGIATACLIAFVRPPFPDWKSLMLIVIIGGPIQYGLAYTAYWLATDVSPVTVANQLWIPF
TTLFAFLILGERLSKAALVGMGVAFVGVAWMTLDAHALQDWKAILVAIAAGAAWGVTTVV
ARRTTSIPPLKMQGLLALGAFPVMAFGSAVFEHGQWEAVKSATPMVWASLLWAGVVSSVL
ATTLLFWLVQRREAGRVTPYLLVTPVVSMFIGWSFMGDILTPQILTGSAITMGGVALVAL
AERGLRAGAAKA