Protein Info for A4249_RS02615 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 15 to 252 (238 residues), 264.3 bits, see alignment E=4.8e-83 PF13525: YfiO" amino acids 42 to 237 (196 residues), 179.1 bits, see alignment E=2.5e-56 PF13512: TPR_18" amino acids 43 to 167 (125 residues), 68.9 bits, see alignment E=1.4e-22 PF13174: TPR_6" amino acids 45 to 75 (31 residues), 15.6 bits, see alignment 5.1e-06 amino acids 84 to 113 (30 residues), 13.3 bits, see alignment (E = 2.8e-05) PF13432: TPR_16" amino acids 85 to 131 (47 residues), 26.6 bits, see alignment 1.7e-09 amino acids 183 to 235 (53 residues), 16.1 bits, see alignment E=3.5e-06

Best Hits

Swiss-Prot: 62% identical to BAMD_CAUVC: Outer membrane protein assembly factor BamD (bamD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K05807, putative lipoprotein (inferred from 72% identity to bsb:Bresu_2662)

Predicted SEED Role

"competence lipoprotein ComL, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NAT6 at UniProt or InterPro

Protein Sequence (284 amino acids)

>A4249_RS02615 outer membrane protein assembly factor BamD (Brevundimonas sp. GW460-12-10-14-LB2)
MGSSLSASKFRSGMVLMAAALAAVTISGCSGTKRPKLAYEERPVEALYNTGYDRLQQRRW
SDAVDYFQEVERQHPYSDWARRSILMQIYAYYQNNAYADAIAAADRFIQLFPGNPSASYA
FYMKAVCNFEQITDVGRDQGYATAALAGLKDVSRRYPGTPYASDAAVKIDMVNDQLAGKE
MNIGRYYQRANQPLAALNRYKAVIANPDFQRTSHTPEALYRLVEVNLQLGLKEEATRNGA
VLGYNYPGSPWYAEAYALLTENGQTPDKVPEGKRESWLQRIIPG