Protein Info for A4249_RS02555 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: tRNA (cytidine(34)-2'-O)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to TRML_BEII9: tRNA (cytidine(34)-2'-O)-methyltransferase (trmL) from Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)

KEGG orthology group: K03216, RNA methyltransferase, TrmH family, group 2 [EC: 2.1.1.-] (inferred from 82% identity to bsb:Bresu_2682)

Predicted SEED Role

"tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207)" (EC 2.1.1.207)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.207

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NAE1 at UniProt or InterPro

Protein Sequence (149 amino acids)

>A4249_RS02555 tRNA (cytidine(34)-2'-O)-methyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MRLALFQPDIPQNVGACIRLSACFGVDLHVIEPTGFRFDDRAMKRAALDYGPLSHMTRHA
DWEAFQADRPAGRLVLLTTKGATPLPDFVFQPDDTLLFGKESAGAPDYVHAAANARVVVP
LRPDARSLNLSVTAGIALWEGLRQTGGVG