Protein Info for A4249_RS02535 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: putative sulfate exporter family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 172 to 196 (25 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 326 to 350 (25 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 27 to 329 (303 residues), 225.6 bits, see alignment E=3.6e-71

Best Hits

Swiss-Prot: 60% identical to Y1914_BRUME: UPF0324 membrane protein BMEI1914 (BMEI1914) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: None (inferred from 56% identity to mrd:Mrad2831_4374)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NAA3 at UniProt or InterPro

Protein Sequence (352 amino acids)

>A4249_RS02535 putative sulfate exporter family transporter (Brevundimonas sp. GW460-12-10-14-LB2)
MKSAALPAPVHAPTLASATAFGRTIRPGVMLCLLVTLAAIGLTSIERDVIGHVWLEPLVL
AILLGAAVRTAWTPDARFKAGIDFSAKMLLEVAVVLLGASVSAATLSSLGVGFVLGIFAL
VALAIVVSFGVGRALGLNARMALLVACGNAICGNSAIAAVAPVIDADGKEVAASIAFTAV
LGVIVVLALPLLGGLIHLNGLQYGALAGLTVYAVPQVLAAAAPFGAVATQTGTVVKLVRV
LMLGPVILALSLIFRDRAPGAAKPGLSRLLPWFIIGFLIMIGLRSFDLIPQAALAPMAAA
SGLLTVVAMAALGLQTDIRAVARAGGRVVAAVVLSLGALVVLALALIRLLGL