Protein Info for A4249_RS02430 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DUF808 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 76 to 95 (20 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details PF05661: DUF808" amino acids 3 to 301 (299 residues), 410.2 bits, see alignment E=2.4e-127

Best Hits

KEGG orthology group: K09781, hypothetical protein (inferred from 70% identity to bsb:Bresu_2731)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N9S4 at UniProt or InterPro

Protein Sequence (314 amino acids)

>A4249_RS02430 DUF808 domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MPSGLIALLDDVAGIAKLAAASLDDVGAAAGKASTKAAGVVVDDAAVTPRYVMGLSPSRE
LPIISKIALGSFRNKLIFILPVALVLSAFAPWAITPILMCGGTYLCFEGAEKLLEAMGHG
GHENATPVARDAAALEKTTVSGAVRTDLILSAEIMAIALADVAAQPILTQAAVLAVVGIA
MTVVVYGAVGLIVKMDDIGLHLAQRPNGGVRALGRGLVKGMPMVMSALSVIGTAAMLWVG
GGILLHGSHTLGLHWPAVPVEHLSHAVGELFGPLAVVMSRLTTAVASAVIGLIVGGVVVL
VLHQVARLRSRESH