Protein Info for A4249_RS02400 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 34 to 193 (160 residues), 67.3 bits, see alignment E=6.2e-23 PF04542: Sigma70_r2" amino acids 38 to 100 (63 residues), 31.4 bits, see alignment E=2.6e-11 PF07638: Sigma70_ECF" amino acids 81 to 183 (103 residues), 22.8 bits, see alignment E=1.6e-08 PF08281: Sigma70_r4_2" amino acids 138 to 188 (51 residues), 52.7 bits, see alignment E=5.3e-18 PF04545: Sigma70_r4" amino acids 143 to 190 (48 residues), 34 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 58% identity to bsb:Bresu_1167)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NW51 at UniProt or InterPro

Protein Sequence (196 amino acids)

>A4249_RS02400 RNA polymerase sigma factor (Brevundimonas sp. GW460-12-10-14-LB2)
MKIVTALKVLARLAAREDFARLTAPAAHPLIAAYLEQREDLARFCRARLGGASGDVDDVL
QDIYLKVSTLDLDPSPDNPRAFLFRLTSNLLMDRWRSGQRSANRDAQWRQLNHETGAAED
LDAAPSAEAVVAGREKLARLLAALDTLPAKTQTVFRLHKFDGVSYADVAVQMGISRSSVE
KHMMDALRVLSRKVQP