Protein Info for A4249_RS02385 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 775 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 188 to 214 (27 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details amino acids 576 to 597 (22 residues), see Phobius details amino acids 616 to 639 (24 residues), see Phobius details amino acids 651 to 672 (22 residues), see Phobius details amino acids 680 to 701 (22 residues), see Phobius details amino acids 708 to 724 (17 residues), see Phobius details amino acids 736 to 756 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 31 to 376 (346 residues), 93.2 bits, see alignment E=1.9e-30 amino acids 421 to 755 (335 residues), 149.9 bits, see alignment E=1.1e-47 PF01061: ABC2_membrane" amino acids 599 to 724 (126 residues), 41 bits, see alignment E=1.7e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NW47 at UniProt or InterPro

Protein Sequence (775 amino acids)

>A4249_RS02385 ABC transporter permease (Brevundimonas sp. GW460-12-10-14-LB2)
MVRTVRRLAAVFVSAVRDEARLLVTRRWDAFVAFGLPLILLMVIAAMLAPGVIRQAPVAV
VDQDNSAFSRAAIRNMEASPGVRVTHAPATMTEAMALMRRGEIYSVAHFPADFSDGAFRR
PEQVTVSFNGAFQTVGALSAWGQSAAIASAAGQQLQERARQRGLPETALQLPAVQVSIVG
NPQLSFELFLGGLLAPGVLHLLAACSAVLAVGRLMQGGSFKCFKAETDGFTTTALIGRLI
PHFVIFSLWGLAWIAWLSGVRGWGVAGSLPLLILGILALMAVSVVLSAFLVAALGEVDMA
FSATAIYSGAAIAFSNGTLPLDHGPRFARIWSDILPYTHYLRLQTGQLVTSATSASAWRD
LMILSGVAVVGFLLMALFIRGRARLVPKPESLNFPLPQQGVIAAFAATFRNLPRARPVSS
LLILAVVLYAFYYPAAYAGQAATGLPIAIATPTQTALTRTLVEDLNASREIEVAAVISSP
AEGFELMRRGVVDGVVVLPQRFEADLVRGAPTGVAIWLNGGYLVRVTAVGKAVAAATAQV
AEAQLKGLPDVARTVRLAPTLEQVSLFNQTEGYGGYAVPAVSLIILQQTLLLGAGVITAV
RRQTAAPRLRRSARLGLWLALTAIGTASSLFYFGFVFWFQDYPRAGNLMGVLLLAPIFSA
AVAAVGLLLGVLFDRHERVLQVLVGTSAPLFFLSGAAWPHFMMPEGLVWLAHLSPSTAAV
QAFVRLNAMGASLSEVSGLAAILTGLALVYGGLWVVRGSLRVTARSSLSQSAAGE