Protein Info for A4249_RS02350 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: GMC family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF00890: FAD_binding_2" amino acids 12 to 45 (34 residues), 22.3 bits, see alignment (E = 1.8e-08) PF13450: NAD_binding_8" amino acids 15 to 43 (29 residues), 22.2 bits, see alignment (E = 3.5e-08) PF00732: GMC_oxred_N" amino acids 80 to 298 (219 residues), 60.2 bits, see alignment E=6.6e-20 PF05199: GMC_oxred_C" amino acids 385 to 500 (116 residues), 78.7 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: None (inferred from 65% identity to xac:XAC2128)

Predicted SEED Role

"Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N9A8 at UniProt or InterPro

Protein Sequence (514 amino acids)

>A4249_RS02350 GMC family oxidoreductase (Brevundimonas sp. GW460-12-10-14-LB2)
MSAPARTAGETDVVIIGSGAGGAPIAARLAKAGLSVTVLEAGRAFDPAEHTPDETTADLY
WMEERLSGGRDPTAFGANNSGQGVGGSLLHWGAFCPRPDPRDLTLASERGRGRDWPFGWD
ELKSYVETVETVIGVSGPADYPWGGRQFAYPPVPRNAPADAMARGATAVGLTVTDAPAAV
LSRDREAGATPHRMACVNCGACHQGCRTGAKGGADNSFLPMAAANGATIIANARAICVER
EVGGRIKSVIYRREGQDHRLNCRALFLCAGGVETPRLLLNWGLGNAGGEVGRNFMTHVAT
QVWGRFDADMSMNRGYPSSLISEEMVRPSDANFAGGYLIQSLGVMPVTLAGGFARGAGLW
GAPLVDTLRNYRRLAGIGINGECLPNDDNRLTLSDEVDAVGLRKARIDFSYGENERRLDA
HARRVMTELWTAAGAEDIFAVARSAHTIGGCRMGDKSDGAVVDADGCSVEIDNLYVCDNS
VFPSALSANPALTLMAVALRTADRFLERQRTGDL