Protein Info for A4249_RS02300 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details PF01694: Rhomboid" amino acids 59 to 209 (151 residues), 91 bits, see alignment E=4.2e-30

Best Hits

KEGG orthology group: None (inferred from 66% identity to bsb:Bresu_2744)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N976 at UniProt or InterPro

Protein Sequence (223 amino acids)

>A4249_RS02300 rhomboid family intramembrane serine protease (Brevundimonas sp. GW460-12-10-14-LB2)
MSDASGRFDPPNSRPAREPMFNVPLVVLLIAASMPTLYLFQRDLPDMGMSMAFAPIDLEQ
GRWGGLLTAMLLHGGWTHAIMNAVAALAFGTPVARLFGTKVGPTVFLLFYLVCGVLASLG
YGLIHWGSSEPMVGASGAVFGLIGAATRLLGGQGRVLPMGDRRVISAAITWMAVNAVTGM
IGGLPGAEGARIAWEAHAVGFVVGFLAIGPLGRMFGSGAAPHP