Protein Info for A4249_RS02260 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 383 (370 residues), 236.1 bits, see alignment E=3e-74

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 82% identity to bsb:Bresu_0005)

Predicted SEED Role

"TrkA-N:Sodium/hydrogen exchanger" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N912 at UniProt or InterPro

Protein Sequence (417 amino acids)

>A4249_RS02260 cation:proton antiporter (Brevundimonas sp. GW460-12-10-14-LB2)
MPHADSLILTLVGGFVLAFVFGMLAHRLKLSPLVGYLVAGVIVGPYTGGFVADTELAPQL
AEIGVILLMFGVGLHFSPKDLMQVRKVAIPGALVQIGVATVLGWGLGRFVLGLGDVEALL
MGFALSVASTVVLLRALEERKQVKGEIGRIAVGWLIVEDLVIVIALVMLPMVLVPAGTQT
DLAALGTDVGLTLLKVVLFVVGMLVVGGKVIPWLLIRIAHTKSRELFTLGVLAIALGIAW
LAYFLFHSFALGAFLAGLVMNASPLGHNAAERSLPLRDAFAVLFFVSVGMLFDPMIVVRQ
PWAVLGVLGIVIVGKSVAALVITQTFKLDRPTGFTVAASLAQIGEFSFILAALGVSLGAM
SRETHDLILAAALLSISLNPFVFLFTDRMGGKPKPPAAGAIRPAAADGPITDAVAAP