Protein Info for A4249_RS02200 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: UDP-glucose/GDP-mannose dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 420 (420 residues), 450.1 bits, E=3.2e-139
• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 175 (175 residues), 217.7 bits, E=1.5e-68
• PF00984: UDPG_MGDP_dh
  • amino acids 207 to 299 (93 residues), 134 bits, E=2.5e-43
• PF03720: UDPG_MGDP_dh_C
  • amino acids 323 to 424 (102 residues), 107.9 bits, E=4.9e-35

Best Hits

Swiss-Prot: 67% identical to UDG_RHIME: UDP-glucose 6-dehydrogenase (rkpK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 80% identity to ccs:CCNA_02464)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (1/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (1/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

See A0A168N8Q9 at UniProt or InterPro

Protein Sequence (440 amino acids)

>A4249_RS02200 UDP-glucose/GDP-mannose dehydrogenase family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MRVAMIGTGYVGLVSGACFADFGHVVTCIDKDPSKIERLERGEIPIYEPGLDDLVAANVR
EGRLFFTLDGAEAIRRADAVFIAVGTPTRRGDGHADLSYVHAAAEEIAGLIEGFTVVVTK
STVPVGTGDEVEAIIRKTNPKADFAVVSNPEFLREGAAIGDFKRPDRVVIGIDDMTGDAG
GRAQKVMSELYRPLNLNESPLLFVGRRTSELIKYAANAFLAMKITFINEMADLCEAVGAD
VQQVARGIGLDKRIGSKFLHAGPGYGGSCFPKDTIALVRTAQQYGAPTKLIEATVEVNDA
RKKAMADRVAATLGTSVQGKTVALLGLTFKPNTDDMRDAPSLDIAPALIAAGATIQAFDP
EGMHEAAKLLPDIQMKDSAYDAVVGADAVVLVTEWDQFRALDLDRIKLLMKQPVLVDLRN
IYRPEDMKHRGFRYMGIGRG