Protein Info for A4249_RS02120 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF12802: MarR_2" amino acids 37 to 92 (56 residues), 32.9 bits, see alignment E=8.4e-12 PF01047: MarR" amino acids 41 to 93 (53 residues), 32.9 bits, see alignment E=7.4e-12 PF13463: HTH_27" amino acids 44 to 102 (59 residues), 24.1 bits, see alignment E=5.6e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N896 at UniProt or InterPro

Protein Sequence (147 amino acids)

>A4249_RS02120 MarR family transcriptional regulator (Brevundimonas sp. GW460-12-10-14-LB2)
MREFDDPAMALYALDTALLELDRQLDRVLRADGQSNAAVRALSLIAGEGRRGVKQCALGS
TLQAPPASLSRLVDHLVRADLVKRSPHPNDRRVTMLEITEAGRAVLDDRRSQYGRLAGLL
TSEGLKTAAQLIPLLQTMAKDVGHTAT