Protein Info for A4249_RS02040 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 366 to 391 (26 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 4 to 389 (386 residues), 173.2 bits, see alignment E=4e-55

Best Hits

KEGG orthology group: None (inferred from 73% identity to cja:CJA_3152)

Predicted SEED Role

"Cation:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N7T0 at UniProt or InterPro

Protein Sequence (416 amino acids)

>A4249_RS02040 cation:proton antiporter (Brevundimonas sp. GW460-12-10-14-LB2)
MATIIAACRIVGWLAKRYLGQPQVVGEMIAGVVLGPSLFGLLAPDLQAALFPKESRSILF
VGAQLGVGLYMFLVGLGFRRDHFRANAKSAAAVSLAGMAAPFLVAVAIAPWLVAEGLFGQ
GIQTWQAMLFMGAAISITAFPMLARIIHERGLSGTRLGSLSLAAGAIDDAGAWCVLAIVL
ASFGAGPMVAVTAIAGGGAFALFMLTLGPKLLAPLGRIVEREGRLSPTVLGVVLILFMLS
AWAMDAVGIHAVFGGFILGVAMPRGLLSDEVKRQLEPFAVLVLLPMFFTFSGLNTQLTMV
NSLGLLAVTVVILLGSILAKGGACWAAARLTGQDNATAMGIGALMNARGLMELIIINIGL
QKGVIGPALFSILVLMAILTTLMASPLFEWVYGRKARERGELGATGDHDDAAPMRA