Protein Info for A4249_RS01975 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sodium/sugar symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 188 to 216 (29 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 433 to 451 (19 residues), see Phobius details amino acids 461 to 483 (23 residues), see Phobius details amino acids 503 to 523 (21 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 39 to 439 (401 residues), 345 bits, see alignment E=3.3e-107 PF00474: SSF" amino acids 39 to 439 (401 residues), 225 bits, see alignment E=7.9e-71

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 85% identity to bsb:Bresu_2085)

Predicted SEED Role

"Predicted sodium-dependent galactose transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N7G1 at UniProt or InterPro

Protein Sequence (524 amino acids)

>A4249_RS01975 sodium/sugar symporter (Brevundimonas sp. GW460-12-10-14-LB2)
MSLAGMDLAILAIYAIFIFGLAQWVSRSKAGEQKTSTDYFMASRSLPWWAIGASLIAANI
SAEQIIGMSGSGYVIGLGIASYEWMAALTLLIVGKFFLPIFLRNEIVTMPQFLQQRYGPT
IRNVMAVFWLLLYVFVNVTSILWLGAIAVHTVTGFNQDYAIVAIGVFALAYQLWGGLKAV
ALTDIVQVALLVCGGLIIGFIALSTIGGAGGAAAGFHTLITQFPDKFDMILSKDNPHYQE
LPGIAVLLGGLWVMNISYWGFNQYIIQRALAAKSLPEAQKGIAFAAYLKLLMPVIVVLPG
MAALILAPNLSAPDQAYPTMMNLLPVGLKGLVFAALIAAIIASLASKVNSISTIFTLDLY
AKIKKDTPEHQLVTVGRIAAVAAVIIGILTARPLLGGFDQAFQFIQEFTGFFTPGIVVIF
MLGLFWKRASEAGALTAAIGSVVLSAIFWWLQETGQFIFPFMNRVSVVFVVSLIAAVIVS
LLVPPKPDAMKIKLDKISYKTSLGFNLAAVGVIAFLILVYTIWW