Protein Info for A4249_RS01940 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: exosortase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 78 to 100 (23 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details TIGR04177: exosortase H, IPTLxxWG-CTERM-specific" amino acids 16 to 167 (152 residues), 119 bits, see alignment E=2e-38 TIGR04178: exosortase/archaeosortase family protein" amino acids 78 to 166 (89 residues), 43.7 bits, see alignment E=2.6e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N783 at UniProt or InterPro

Protein Sequence (183 amino acids)

>A4249_RS01940 exosortase H (Brevundimonas sp. GW460-12-10-14-LB2)
MPRATSMLKSPAIQYLGLFLLITVALFSVLATPWAERLFVAPFTRSLVHVCALLIDLVDD
RVIADGAILRFDDGKGAVQVLAGCNAVEVCALLTAAIIAFPGKLRYGLIGAAAGIVALQT
INLLRIISLLYLSRGSQEVFEFFHHYVWDAMIGLEGLLIFFFWTRWQVRREASDRTAATP
VAA