Protein Info for A4249_RS01905 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: TrbC/VirB2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details PF04956: TrbC" amino acids 12 to 100 (89 residues), 63 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 58% identity to ccr:CC_2417)

Predicted SEED Role

"Major pilus subunit of type IV secretion complex (VirB2)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N706 at UniProt or InterPro

Protein Sequence (108 amino acids)

>A4249_RS01905 TrbC/VirB2 family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSRVVARVRDVAAACVAIFTPAVAQAQSLMADPQGSGPIVKAVQWLQGTLLGTIATVVAV
IAVACVGFLMLSGRLNWRYGAIVILGCFILFGAASIVAGIRSTAMMGG