Protein Info for A4249_RS01895 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: VirB4 family type IV secretion/conjugal transfer ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 790 TIGR00929: type IV secretion/conjugal transfer ATPase, VirB4 family" amino acids 15 to 789 (775 residues), 749.8 bits, see alignment E=1.9e-229 PF03135: CagE_TrbE_VirB" amino acids 184 to 388 (205 residues), 154.5 bits, see alignment E=3.7e-49 PF19044: P-loop_TraG" amino acids 572 to 703 (132 residues), 37.9 bits, see alignment E=8.8e-14

Best Hits

KEGG orthology group: K03199, type IV secretion system protein VirB4 (inferred from 55% identity to eli:ELI_03225)

Predicted SEED Role

"ATPase provides energy for both assembly of type IV secretion complex and secretion of T-DNA complex (VirB4)" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N6Y6 at UniProt or InterPro

Protein Sequence (790 amino acids)

>A4249_RS01895 VirB4 family type IV secretion/conjugal transfer ATPase (Brevundimonas sp. GW460-12-10-14-LB2)
MQLVPALSQGRRSVRREQPAGAHLPYARHVDDHTLEMRDGLLLQVIRLRGLLFETADTAE
LNYRKALRDAMLRAVGTSRFALYHHIERRRLDVVGEDRFPDPFSQALGERWSDRLNTKAL
FANDLYLTLVRRPLQGRLGVADRLRTWLGRAVEQDDLAHAHELAQLNAGREALVAALGDY
EPRLLGVRETPNGFCSEPLEFLSALYNGEQRPVLMPHQDLGAYLPYRRVSFGQDAIELAP
AGHLRRRFVGIVSIKDYPTYSAPGLFDELMRLPHELTITQSFAFVERQAALEKMNLALRR
MRSTEDEALSLRGELMQAKDEVAAGRAGYGEHHMTIAVRADTLEAVDAGVAEVTAVLGDL
GVVAVREDIALEPAFWAQFPANFNYIARRGLISTNNFAGLASIHNFPLGSPSDNHWGPAV
TLLETTAAGPYFFNFHQGDLGNFTIIGPSGSGKTVVLNFLLAQARKLSPRIIFFDKDRGA
ELFIRALGGRYDVLRPGSASGLNPLQIEDTPINRAFLVDWLTALAGATDLEDLERIRDAV
AANFDQAREDRRLRHLVELFRGDRRPHAGDLWSRLRPWWGDGERAWLFDNPEDLTDLTID
TVGFDMTVLLDDPTLRTPAMMYLFHRVEERLDGSPAIIVVDEGWKALDDDVFVRRIKDWE
KTIRKRNGIVGFATQSAQDALESRIASAIVEQAATQIFMINPKARAEDYVGGFGLTPHEF
DLVRSLPDSSHCFLVKHGGDSVIARLDLSGERDLLTILSGRERSVRLLDQIRAEVGDDPA
DWMPVLLEAV