Protein Info for A4249_RS01870 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: P-type DNA transfer ATPase VirB11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR02788: P-type DNA transfer ATPase VirB11" amino acids 23 to 326 (304 residues), 360.2 bits, see alignment E=3.9e-112 PF00437: T2SSE" amino acids 25 to 316 (292 residues), 201 bits, see alignment E=1.1e-63

Best Hits

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 59% identity to ccr:CC_2423)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N6S9 at UniProt or InterPro

Protein Sequence (333 amino acids)

>A4249_RS01870 P-type DNA transfer ATPase VirB11 (Brevundimonas sp. GW460-12-10-14-LB2)
MSDGGAPGQVYLHRYLAALAPLLARPDITDLYVNRPGEIWAETLGGAIEHHETPELSTET
LTRLARQIAAHGHQGISREHPILSATLPGGERVQIVMAPATRGPIAIAIRKQVSADLRLD
DYAAAGAFADVKLGGQAGQAEVDEQLRALSNAGDATTLLKTAVAARRNILISGGTSTGKT
TFLNALIREIPLQERLILIEDAPELNLRHPNGVGLLAARSPLGEAAVTAEDLLNASLRMR
PDRIILGELRGPEAYTFLRAVNTGHPGSMTTIHADSPERAVEQLALLVLQGASTLNRNDV
LHYVRASVDVFVQLDRPNGRRTISEVRLRESTE