Protein Info for A4249_RS01730 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: glucans biosynthesis glucosyltransferase MdoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 123 (27 residues), see Phobius details amino acids 413 to 439 (27 residues), see Phobius details amino acids 459 to 481 (23 residues), see Phobius details amino acids 501 to 523 (23 residues), see Phobius details amino acids 552 to 568 (17 residues), see Phobius details amino acids 574 to 593 (20 residues), see Phobius details amino acids 631 to 647 (17 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 148 to 325 (178 residues), 42 bits, see alignment E=1.5e-14 PF13506: Glyco_transf_21" amino acids 237 to 389 (153 residues), 38.8 bits, see alignment E=1.1e-13 PF13632: Glyco_trans_2_3" amino acids 242 to 448 (207 residues), 61.1 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 71% identity to bsb:Bresu_2311)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N5X0 at UniProt or InterPro

Protein Sequence (654 amino acids)

>A4249_RS01730 glucans biosynthesis glucosyltransferase MdoH (Brevundimonas sp. GW460-12-10-14-LB2)
MNKLAIRPVEQAEIETTIRGAQTPSWSWLPDEAPLAMPVQSLSAPDAVADVTPATSPRTV
ATRRLALLAGTIVLTGLSAITPFYLYARKGWDGTEILAFGLFMVLITAISCWFVSGLMGL
FVMLRGKDQADLAFSPHPPMPRTRTALLMPLYNEDARSSFARLSQIDSCLARLGASSAFD
IFVLSDSTKEDTAAAERSVFQAFRLAANSKAFYRRRTDNAERKAGNLAEWVRRFGGAYEN
MIVLDADSTMAGETLLRMVDAMERNPGVGLIQTAPVIIKGRTIFARVSQYSVRLYGRVAA
AGLAYWTGSESSYWGHNAIIRTRAFAACCGLPHLKGRKPFGGHIMSHDVVEAALMRRAGW
AVHVTASLDGSWEETPPSITDFIRRDHRWFQGNLQHLGLITAKGLSPMSRLQLLMGCMAY
LSSPLWLASLMVGLFIQMFYPVDWTSFFYILNPQFTPFMLASFLSGVLLIGPKFMGAALV
LSRPAELRAFGGRRAIAKGMAAEIALSAILAPILMVANTKAFIQIVSGHDTGWSTQQREA
DGLAWSDAFRAMRWQMIAGVGFLIPLAVRPDLATWFAPIVLPLLLAAPITVWTSRVRSGD
KLAAKGYLVTPVQDGVSVSPAVLHTPRSPLRAVAGGVLAPVAAPAMVPARAPER