Protein Info for A4249_RS01720 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 87 to 275 (189 residues), 162.7 bits, E=1.1e-51
• PF08659: KR
  • amino acids 88 to 246 (159 residues), 44.9 bits, E=2e-15
• PF13561: adh_short_C2
  • amino acids 91 to 325 (235 residues), 203 bits, E=8.5e-64

Best Hits

Swiss-Prot: 48% identical to YHXC_BACSU: Uncharacterized oxidoreductase YhxC (yhxC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 84% identity to bsb:Bresu_0928)

MetaCyc: 42% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (2/6 steps found)
• biotin biosynthesis I (8/15 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (26/205 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A168N5V3 at UniProt or InterPro

Protein Sequence (328 amino acids)

>A4249_RS01720 SDR family oxidoreductase (Brevundimonas sp. GW460-12-10-14-LB2)
MDDRTQARAEDIADQERAIQRDIDARDKASGDDKPSGAMQAGARPYPEPPFPKQHQTKPG
DEAALDPAPLYDAPFWKGSGKLDGFAALITGADSGIGRSVAVLFAREGCDVVICHLDEDA
DAETTKAAVEAEGRRAVVLKGDVSDPAFAEMAVKATLDAFGRLDVLVPNAAFQEHVPAFE
DLTYAHFDRTLKTNLYGYFNMTKAAVPHMKAGGAIVMTGSVTGLMGNKDLLDYSLTKGGI
HAYARSLGTHLAPRGIRVNVVAPGPVWTPLNPADKDAEATSKFGADTVMKRPAQPEEIAP
AYVFLASPQMSSFITGEILPIIGGYAGG