Protein Info for A4249_RS01665 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 39 to 193 (155 residues), 149.9 bits, E=3.8e-48

Best Hits

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 78% identity to bsb:Bresu_1087)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (5/7 steps found)
• cyanate degradation (2/3 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See A0A168N5G2 at UniProt or InterPro

Protein Sequence (207 amino acids)

>A4249_RS01665 carbonic anhydrase (Brevundimonas sp. GW460-12-10-14-LB2)
MSDIEDELTAGYRRFRAEHWPTARAEYETLATKGQKPHTLIVACSDSRADPALIFDAKPG
ELFVVRNVANLVPPYEPDGKLHGVSAALEFGVKVLGVKRIVVMGHAHCGGVNAMINGAPE
IVADFVAPWIAQGAPVVQHVAETVAPDQLERAAEEAIVRLSIRNLRTFPWIAEREAKGEL
QLSGLHFGIAEGALTALTDKPRFEPLD