Protein Info for A4249_RS01660 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  • amino acids 10 to 211 (202 residues), 135.9 bits, E=1.1e-43
• PF01066: CDP-OH_P_transf
  • amino acids 10 to 198 (189 residues), 109.5 bits, E=1e-35

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• cardiolipin biosynthesis I (1/3 steps found)
• cardiolipin biosynthesis II (1/3 steps found)
• cardiolipin biosynthesis III (1/3 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (7/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (5/13 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (3/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (7/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

See A0A168NVW5 at UniProt or InterPro

Protein Sequence (214 amino acids)

>A4249_RS01660 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTSAHRANPIPNILTGLRLAAGVVMFAMMAGAAPGALEAWLSPETQGRFSVWAFWIFVIA
ASTDWVDGYLARRWNATTRWGAILDPIADKVLVTGAILGVLASGSLPGIALPCGLILFRE
FAVSALRETMAGRIELPVTLAAKWKTTVQMVALAALQLTLLWGALGLQNDDGSPLAWQPA
FESFAIFLIWFAAIITLWTGWQYFSEARRQMRDL