Protein Info for A4249_RS01600 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 76 to 122 (47 residues), 39.1 bits, see alignment 1.2e-13 PF16576: HlyD_D23" amino acids 228 to 318 (91 residues), 55.2 bits, see alignment E=1.5e-18 PF13437: HlyD_3" amino acids 242 to 360 (119 residues), 56.6 bits, see alignment E=9.9e-19 PF00529: CusB_dom_1" amino acids 274 to 368 (95 residues), 29.5 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 38% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: None (inferred from 66% identity to bsb:Bresu_0845)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N4Z5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>A4249_RS01600 HlyD family secretion protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTDAAPPAPASSAPAAPQAPAAAPPAPAPKKNVMWTVIAAGVALLGVLMVLYAWQLPPFR
GAIQRTDNAYVRGQVTIISPQVNGYVVQVPVQDFQTVHQGQLLAQVDDRIYRQRLEQAEA
SLHSAQAALSNSTQTQASARGSVAQQRASIAAAEATLTRAQADANRARTLKAGGWVAQAN
VDVAEAALRSAQAQVAQARAAEGIAQTGVTSAVVGRDSLAAAVENAQAAVRLAQIDLANT
RIVAPRAGRLGEIGVRQGQYVTAGTQLMGLVPDVVWVTANMKETQMKNIRVGQPVEITVD
ALGGQTLRGHVERIAPAAGSEFSVIRPDNATGNFTKVAQRIPVRIRIDPNQPAAERLAPG
MSVVAKVNTAG