Protein Info for A4249_RS01560 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: histidine kinase dimerization/phosphoacceptor domain -containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00989: PAS" amino acids 25 to 132 (108 residues), 41.8 bits, see alignment E=4.4e-14 PF13426: PAS_9" amino acids 41 to 137 (97 residues), 81.8 bits, see alignment E=1.7e-26 TIGR00229: PAS domain S-box protein" amino acids 42 to 142 (101 residues), 66.5 bits, see alignment E=1.2e-22 PF08448: PAS_4" amino acids 46 to 138 (93 residues), 35.1 bits, see alignment E=6e-12 PF08447: PAS_3" amino acids 46 to 127 (82 residues), 31.3 bits, see alignment E=9.3e-11 PF07568: HisKA_2" amino acids 176 to 249 (74 residues), 78.2 bits, see alignment E=1.8e-25 PF07536: HWE_HK" amino acids 176 to 229 (54 residues), 32.1 bits, see alignment 7e-11 PF13581: HATPase_c_2" amino acids 267 to 326 (60 residues), 33 bits, see alignment E=2.5e-11 PF02518: HATPase_c" amino acids 274 to 362 (89 residues), 39.5 bits, see alignment E=3.1e-13

Best Hits

KEGG orthology group: None (inferred from 54% identity to cse:Cseg_3871)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N4S3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>A4249_RS01560 histidine kinase dimerization/phosphoacceptor domain -containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MKQQDDWRLTDVVEHEIGRGDPFAAAIRGTRMPMVITDPRRDDNPIVFANKAFQDLTGYE
RDEIIGQNCRFLQGPKSDKAAVAKIREALEAGADIHIDLLNYRKDGSTFWNALFISPVRN
AHGDIEYFFASQLDVTERIEAQAYVEKQKALVEREVAARTADLQEALAAKTLLLHEVDHR
VKNNLTMIGSLLRLQSRSLSDPALTATLDSMLERVDALATVHRKLYQSEDVTQFDVGAFT
NTLVADVIGSTGRTDIEVSVDVEPMFIPSTHASSIGLIINELLTNAIKHAFAEDRGGRLI
VSAKRTEQGGQVVVQDDGPGIPGAAHQGLGKTLIGRLSKQIGGKTLWLPADPGTRAVVDF
PVSG