Protein Info for A4249_RS01505 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 30 to 76 (47 residues), 29.9 bits, 8.8e-11
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 36 to 459 (424 residues), 296.5 bits, E=1.7e-92
• PF08245: Mur_ligase_M
  • amino acids 110 to 299 (190 residues), 115.8 bits, E=3.8e-37
• PF02875: Mur_ligase_C
  • amino acids 331 to 388 (58 residues), 27.2 bits, 6e-10

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 71% identity to bsb:Bresu_2780)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See A0A168N4D6 at UniProt or InterPro

Protein Sequence (472 amino acids)

>A4249_RS01505 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Brevundimonas sp. GW460-12-10-14-LB2)
MPENSARPLWSAAEVAAATGGVLHGDDRPITGLTYNSREIVPGDLFLALKGERDGHQFAS
GAFASGAAAALVEHPVEGGPCVVVPDTLRGLEALGVAARERAPHVKRGAVTGSVGKTSVT
QAIKAGLDLAGPAHGSIKSYNNHIGVPLTLARMPVETQRAVFEIGMNAPGEIAPLSRFVA
PHAACVTTVGPVHIEAFADGEAGVAREKATIFQGLVPGGAAVANGDVAFSAVLCDAAKAV
GARLLTFGSDAGHDARLLDFRPDAEGAAVAVELFGRRIDYRLAQSGAHWGLNSLCVLLML
DALDVTLDTGLEALAGFQPLAGRGQTRTVTTPDGAFTLIDESYNANPLSMAAGFKTLGAR
STSGRRVVVLTDMLELGEQSRDLHEGLAGPIDAAGLDLVHAAGPEMRWLYDALPVSRRGV
WRATAAELAAEAALLVAPGDIVMVKGSNGSKASLVAKALAELQGRDTTPATR