Protein Info for A4249_RS01090 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF07638: Sigma70_ECF" amino acids 17 to 161 (145 residues), 35.1 bits, see alignment E=1.9e-12 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 37 to 171 (135 residues), 66.4 bits, see alignment E=1.2e-22 PF04542: Sigma70_r2" amino acids 40 to 95 (56 residues), 59 bits, see alignment E=4.8e-20 PF08281: Sigma70_r4_2" amino acids 119 to 171 (53 residues), 29.3 bits, see alignment E=8.3e-11

Best Hits

Swiss-Prot: 56% identical to SIGF_CAUVN: ECF RNA polymerase sigma factor SigF (sigF) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 71% identity to bsb:Bresu_2308)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N1I8 at UniProt or InterPro

Protein Sequence (186 amino acids)

>A4249_RS01090 sigma-70 family RNA polymerase sigma factor (Brevundimonas sp. GW460-12-10-14-LB2)
MLDRESQLKALMLNGLDGDAQAWRVLLSDLAAHLRPFFKRRLFNGESDAEDLVQETLIAI
HAKRATWDRNQSFTAWAFTIARHKLIDHLRRQGRRLTEPLDDASVLLAEHTVEDGVMRRD
LTRALSILPARQRALIHDVKVTGLSVAEAAERHGYSVAAAKVSIHRSFKALTARFAAGAA
GSNDED