Protein Info for A4249_RS01065 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 96 to 122 (27 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 404 to 436 (33 residues), see Phobius details amino acids 442 to 464 (23 residues), see Phobius details amino acids 476 to 497 (22 residues), see Phobius details amino acids 503 to 521 (19 residues), see Phobius details amino acids 531 to 549 (19 residues), see Phobius details amino acids 569 to 589 (21 residues), see Phobius details PF03600: CitMHS" amino acids 18 to 538 (521 residues), 221.5 bits, see alignment E=2.5e-69 amino acids 490 to 578 (89 residues), 35 bits, see alignment E=1.3e-12 PF02080: TrkA_C" amino acids 311 to 377 (67 residues), 31.9 bits, see alignment E=1.4e-11 PF00939: Na_sulph_symp" amino acids 451 to 590 (140 residues), 27.5 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: None (inferred from 82% identity to bsb:Bresu_0724)

Predicted SEED Role

"TrkA family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N1D3 at UniProt or InterPro

Protein Sequence (591 amino acids)

>A4249_RS01065 SLC13 family permease (Brevundimonas sp. GW460-12-10-14-LB2)
MTFQQGLAFGLVGLTIGAFIWGRFRYDLVAVVALVAGLAIGIIPAEAAFDGFKNDVTVII
ACALIVSAAFARSGVIELAMRRVMPLLKTERSQVPVLTGAVTLLSMATKNVGALAIMMPV
ALQLARQTKSSPSRLLMPMAFGAMAGGMVTLVGTAPNIIVAEVRQAIVGEPFAMFDYAPV
GLALTLIALAFLAFGYRLLPRDRQGATSMSAALAANAYATEVRAPEGWAPGSMTVSALAA
LGDDEVKIMALIRSGKRRLSPRGNVVVKAGDALLIEGEQQALEGFVSRAQMNLIRDDRPV
PIATASEEIAIVEAVIGRNSPLQGQSVRSSDLYGQHGINLLGVSRSGFQLTQHLRTAKLA
PGDIILLQGAEQALPVALRALDLLPLAERQVQLGSVRRRFMPAVVLACAMTLVGLGLVPV
AVAFFGAAVVIVALGGLKMREAYAALDGPLLVLIAALIPVSDAIQSTGGSDLIAGLLRHV
FTGLPGVVAITGVMLASMAVTPFLNNAATVLIVAPIGATLAKQLGYNPDPFLMAVAVGAA
CDFLTPIGHQCNTLVMGPGGYKFSDYPRLGAPLSALVLVTGPSLILLFWPL