Protein Info for A4249_RS00820 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details PF03988: DUF347" amino acids 23 to 73 (51 residues), 63 bits, see alignment 1.2e-21 amino acids 78 to 126 (49 residues), 51 bits, see alignment 6.7e-18 amino acids 143 to 193 (51 residues), 51 bits, see alignment 6.8e-18 amino acids 198 to 249 (52 residues), 52.5 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: None (inferred from 66% identity to bur:Bcep18194_A5848)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160I1W9 at UniProt or InterPro

Protein Sequence (262 amino acids)

>A4249_RS00820 hypothetical protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSTTPAEPSIAGTVDKVAKVTLAFWLMKICATTVGETGGDLVSMTLKVGYAVSSLILLGF
FVITLIAQLRSKRFNPALYWLVILSTSTAGTTLSDFMDRSLGLGYATGATIIAGVLIAVL
AAWRLTYGSLKVDHIREPGVETFYWLAILASNTLGTALGDFLADTSGLGYLWSNALISGG
IVLTILAWKFTRISTTVLFWIAFVLTRPFGATMGDLLTKSHAKGGLDLGTIGSTAALLGL
LVVLLIATTANYRKWFTGARPA