Protein Info for A4249_RS00660 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cell wall hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF07486: Hydrolase_2" amino acids 162 to 270 (109 residues), 89 bits, see alignment E=1.4e-29

Best Hits

KEGG orthology group: None (inferred from 68% identity to bsb:Bresu_0974)

Predicted SEED Role

"Cell wall hydrolyses involved in spore germination"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MZ99 at UniProt or InterPro

Protein Sequence (393 amino acids)

>A4249_RS00660 cell wall hydrolase (Brevundimonas sp. GW460-12-10-14-LB2)
MTRLPWKTMWKALRRSAAALPAAGAVLGVAMAAGSSVRPDMDRTAEAVSRITGGDLGAGG
LAAIKGRLTPSQLAVAMRHDPNLLQPALYGLTPGWESLTLAGKPGLESGKSGLEAQRLNA
AMAPASGALRPALPFVFKGSAEDRRRALRCLTQAVYYEAALEPDNGQAGVAQVVLNRVRD
PNYASTVCGVVFEGAERVTGCQFSFTCDGSLGQAPVGWAWERARKVAERALNGAVAQEVG
TATHYHADYVHPWWAPTVAKVTQIGAHIFYRWKGVYGETAAFRKTYNGREPAIDEARFSR
PRMTIAAGSATGGADPDAPLKDAPLKTVEIHGQQRVVGVVSLGGRRLPTRDEVAAINARL
NALERPASSTKPADTAPTGVTTMDVEEVGRPAN