Protein Info for A4249_RS00610 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 735 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 31 to 32 (2 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details PF02743: dCache_1" amino acids 46 to 255 (210 residues), 52.3 bits, see alignment E=8.4e-18 PF00672: HAMP" amino acids 342 to 390 (49 residues), 27.6 bits, see alignment 4.4e-10 PF00015: MCPsignal" amino acids 536 to 691 (156 residues), 160.6 bits, see alignment E=5.2e-51

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 56% identity to ccr:CC_2281)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MYZ4 at UniProt or InterPro

Protein Sequence (735 amino acids)

>A4249_RS00610 methyl-accepting chemotaxis protein (Brevundimonas sp. GW460-12-10-14-LB2)
MFSFNRLSIALKLAVVAGLAIGALMIVAAIGVTAYSGAIVRDMAGRYAESAAQEASQEIR
NEIVSAGTGAKTLAATLGAALQTGLTDRTAYMGLVKPNAEATDQVMGAWFMAAPDAVGAD
AAHIGDAATSSNVNGRLSIYWVRRDGQISLEPEADGSDFEQAYYTEPMASGAPVVVEPYE
ESIGGGKVAMTSVAYPVRANGRIIGVAGLDITLANLSQRLAAMRPLGTGRVTLVSNKGVW
VAHPDTAVRGQAYADAGADIVRNVIAERQAQAVEGVSVNGEPVRRLVQPVILPGQKATWA
VVLDIPVATIEAPARQLALMLLVGGVLIIAAIIVALLITSDRLIRRPFARLTADVRTMSE
GRYDIPVAGADKADELGQIARALEGFRLELADGLARRDQQQRERAAAETDRRRHAEETEL
FAASQTRAVETLGEGLSRLAAGDLAWRMPEAGFTADTRRIPEDYNAALHQLHTTMTGIWT
TAQSMRGGCQDIAAAADSLSRRTEQQAAGLEQTAAALDELTQTVRSSAENAERARDITQA
AQAAADKGEAVVQDAIGAMSEIEQSSTQINQIVGVIDEIAFQTSLLALNAGVEAARAGEA
GRGFAVVASEVRGLAERSASAAKEIKALIALSQSNVQRGSDQVSLTRDSLSAIAVQVAEA
NALVRTIAAATREQSVGIGEINVAINQMDQFTQQNAAMVEESTAASHALTNEAGELEGLI
SRFDLGQTTQSRRAA